PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01063.1.g00360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 385aa    MW: 40914.3 Da    PI: 5.4035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01063.1.g00360.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg W++eEd++l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc01063.1.g00360.1.am.mk 14 RGLWSPEEDDKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                                  788*******************************************97 PP

2Myb_DNA-binding51.72e-1667111147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++++eE++l+++++  lG++ W+ Ia+ ++ gRt++++k++w++y
  Zmw_sc01063.1.g00360.1.am.mk  67 RGAFSQEEEDLIIHLHSVLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                                   89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.668961IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-25964IPR009057Homeodomain-like
SuperFamilySSF466891.27E-2912108IPR009057Homeodomain-like
SMARTSM007175.3E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001671.52E-111761No hitNo description
PROSITE profilePS5129426.75962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002493.4E-1567111IPR001005SANT/Myb domain
CDDcd001674.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MARRVAGPKK KLRRGLWSPE EDDKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LKPDLKRGAF SQEEEDLIIH LHSVLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRQRG  120
IDPATHKPLA VEAASSGRAA SAASSRSAVF VDAEFILSST TAGQHMPPLA VTAESYNDMY  180
SHSCAEGGGS ARAALVGGAC SDGSLSLSGY NQTADLATGY LDPAVVLPSV SSSSTLNSIA  240
GLSPAATDEQ CNNSNSAFES TPSCSAAATD HLPWLELGSS SYCTTAAAVD HYGAALDELK  300
WSEYVFDGYG AAQYQQPGQG VYGDSKDAVQ FDADGLSSWL LPCWSPLLRW RLEGPPDGRT  360
AADGPTGSDG ADAENDGQAE SPFAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
1h8a_C4e-291111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.11e-145PREDICTED: myb-related protein Zm1-like
TrEMBLA0A0A9P2E31e-160A0A0A9P2E3_ARUDO; Uncharacterized protein
STRINGSi029872m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385